PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10012556m
Common NameCICLE_v10012556mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 251aa    MW: 28602.5 Da    PI: 7.0552
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10012556mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.34.1e-29137191155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+ Wt++LHe+Fve+v++LGGsekAtPk+il+lmk k L++ +vkSHLQkYR+
  Ciclev10012556m 137 KKRITWTKDLHEHFVECVNRLGGSEKATPKAILKLMKSKELSILQVKSHLQKYRS 191
                      68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.714134194IPR017930Myb domain
SuperFamilySSF466893.85E-16135191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-25135192IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-23137192IPR006447Myb domain, plants
PfamPF002495.4E-8141190IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEAQSQEKQN LEPGKMPSSI ISSYHLQELA SAFYLTDQCF FGFHQNQHKN NEVIEASLPP  60
SNQFSGDNFS EKLSELDTLE SLVLSSNHNR KFPRKISSIP TPSESSQNTK NMSIFSSEEK  120
QSCGLISDSY RHILSNKKRI TWTKDLHEHF VECVNRLGGS EKATPKAILK LMKSKELSIL  180
QVKSHLQKYR SEKLISDQSL QGFPEKTVCI NDIPQLYMKM SMQIREALQL QLELEKHLHD  240
QLEACTSIEL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429843.10.0hypothetical protein CICLE_v10012556mg
TrEMBLV4S6I60.0V4S6I6_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2753133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.21e-29G2-like family protein